PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00012.223
Common NameAMTR_s00012p00243090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 353aa    MW: 37232.1 Da    PI: 7.5507
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00012.223genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52.1e-31111167258
                                               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                                      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                                               dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+ve+s edp++++itYeg H h
  evm_27.model.AmTr_v1.0_scaffold00012.223 111 DDGYQWRKYGQKSIKNSPHPRSYYRCTNPRCSAKKQVEKSIEDPDTLVITYEGLHLH 167
                                               8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.291105170IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-29106168IPR003657WRKY domain
SuperFamilySSF1182901.96E-26108168IPR003657WRKY domain
SMARTSM007742.8E-36110169IPR003657WRKY domain
PfamPF031063.2E-25111167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAESEEMREN WSDGLGEELV RELLDDETPF LLLPNTGPEA CLSSFLSRLY SGPTIDEIET  60
ALSAARRDDP GSKREDHSAL RSTVTLLDKG RNKMDNKYTL SIKSCGNRVA DDGYQWRKYG  120
QKSIKNSPHP RSYYRCTNPR CSAKKQVEKS IEDPDTLVIT YEGLHLHYAY SHFQLRHPLT  180
YAPPPQPPNQ LSKTRHTHFD CKHPIASTDN NNNNSVDPLT HTLAKKIKAN PLLETSTLMG  240
DQDKGTSTQD LNDKRAVGNG GGGRRRGGGG GGVAGGGGGG GGGGGGGGGG GGGGGGSGVS  300
LSPGSTSFEG LLEDIVPIGI RKPLNVLGTC SLSTSSPSSS SSCSSSSLSW SP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-191111671874Probable WRKY transcription factor 4
2lex_A1e-191111671874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261269GGRRRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846260.20.0PREDICTED: probable WRKY transcription factor 49
TrEMBLW1PLB80.0W1PLB8_AMBTC; Uncharacterized protein
STRINGVIT_08s0007g00570.t012e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-40WRKY DNA-binding protein 49
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]